| Class d: Alpha and beta proteins (a+b) [53931] (286 folds) |
| Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily) 4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication |
Superfamily d.159.1: Metallo-dependent phosphatases [56300] (9 families) ![]() different families of this superfamily are groupped in a single Pfam family, Pfam 00149 |
| Family d.159.1.3: Protein serine/threonine phosphatase [56310] (4 proteins) |
| Protein lambda ser/thr protein phosphatase [64431] (1 species) |
| Species Bacteriophage lambda [TaxId:10710] [64432] (1 PDB entry) |
| Domain d1g5bb_: 1g5b B: [60262] |
PDB Entry: 1g5b (more details), 2.15 Å
SCOP Domain Sequences for d1g5bb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1g5bb_ d.159.1.3 (B:) lambda ser/thr protein phosphatase {Bacteriophage lambda}
mryyekidgskyrniwvvgdlhgcytnlmnkldtigfdnkkdllisvgdlvdrgaenvec
lelitfpwfravrgnheqmmidglsergnvnhwllngggwffnldydkeilakalahkad
elpliielvskdkkyvichadypfdeyefgkpvdhqqviwnrerisnsqngivkeikgad
tfifghtpavkplkfanqmyidtgavfcgnltliqvqgaga
Timeline for d1g5bb_: