Lineage for d1g5ba_ (1g5b A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2998036Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily)
    4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication
  4. 2998037Superfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families) (S)
    different families of this superfamily are groupped in a single Pfam family, Pfam PF00149
  5. 2998136Family d.159.1.3: Protein serine/threonine phosphatase [56310] (6 proteins)
  6. 2998137Protein lambda ser/thr protein phosphatase [64431] (1 species)
  7. 2998138Species Bacteriophage lambda [TaxId:10710] [64432] (1 PDB entry)
  8. 2998139Domain d1g5ba_: 1g5b A: [60261]
    complexed with hg, mn, so4
    missing some secondary structures that made up less than one-third of the common domain

Details for d1g5ba_

PDB Entry: 1g5b (more details), 2.15 Å

PDB Description: bacteriophage lambda ser/thr protein phosphatase
PDB Compounds: (A:) serine/threonine protein phosphatase

SCOPe Domain Sequences for d1g5ba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g5ba_ d.159.1.3 (A:) lambda ser/thr protein phosphatase {Bacteriophage lambda [TaxId: 10710]}
mryyekidgskyrniwvvgdlhgcytnlmnkldtigfdnkkdllisvgdlvdrgaenvec
lelitfpwfravrgnheqmmidglsergnvnhwllngggwffnldydkeilakalahkad
elpliielvskdkkyvichadypfdeyefgkpvdhqqviwnrerisnsqngivkeikgad
tfifghtpavkplkfanqmyidtgavfcgnltliqvqga

SCOPe Domain Coordinates for d1g5ba_:

Click to download the PDB-style file with coordinates for d1g5ba_.
(The format of our PDB-style files is described here.)

Timeline for d1g5ba_: