Lineage for d1g59c2 (1g59 C:1-305)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 579981Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 579982Superfamily c.26.1: Nucleotidylyl transferase [52374] (5 families) (S)
  5. 579983Family c.26.1.1: Class I aminoacyl-tRNA synthetases (RS), catalytic domain [52375] (12 proteins)
    contains a conserved all-alpha subdomain at the C-terminal extension
  6. 580020Protein Glutamyl-tRNA synthetase (GluRS) [52382] (1 species)
    Catalytic domain is very similar to that of GlnRS
  7. 580021Species Thermus thermophilus [TaxId:274] [52383] (6 PDB entries)
  8. 580030Domain d1g59c2: 1g59 C:1-305 [60260]
    Other proteins in same PDB: d1g59a1, d1g59c1

Details for d1g59c2

PDB Entry: 1g59 (more details), 2.4 Å

PDB Description: glutamyl-trna synthetase complexed with trna(glu).

SCOP Domain Sequences for d1g59c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g59c2 c.26.1.1 (C:1-305) Glutamyl-tRNA synthetase (GluRS) {Thermus thermophilus}
mvvtriapsptgdphvgtayialfnyawarrnggrfivriedtdraryvpgaeerilaal
kwlglsydegpdvaaptgpyrqserlplyqkyaeellkrgwayrafetpeeleqirkekg
gydgrarnippeeaeerarrgephvirlkvprpgttevkdelrgvvvydnqeipdvvllk
sdgyptyhlanvvddhlmgvtdviraeewlvstpihvllyrafgweaprfyhmpllrnpd
ktkiskrkshtsldwykaegflpealrnylclmgfsmpdgreiftleefiqaftwervsl
ggpvf

SCOP Domain Coordinates for d1g59c2:

Click to download the PDB-style file with coordinates for d1g59c2.
(The format of our PDB-style files is described here.)

Timeline for d1g59c2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1g59c1