Lineage for d1g59a2 (1g59 A:1-305)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 827433Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 827434Superfamily c.26.1: Nucleotidylyl transferase [52374] (5 families) (S)
  5. 827435Family c.26.1.1: Class I aminoacyl-tRNA synthetases (RS), catalytic domain [52375] (12 proteins)
    contains a conserved all-alpha subdomain at the C-terminal extension
  6. 827477Protein Glutamyl-tRNA synthetase (GluRS) [52382] (1 species)
    Catalytic domain is very similar to that of GlnRS
  7. 827478Species Thermus thermophilus [TaxId:274] [52383] (11 PDB entries)
  8. 827495Domain d1g59a2: 1g59 A:1-305 [60258]
    Other proteins in same PDB: d1g59a1, d1g59c1

Details for d1g59a2

PDB Entry: 1g59 (more details), 2.4 Å

PDB Description: glutamyl-trna synthetase complexed with trna(glu).
PDB Compounds: (A:) Glutamyl-tRNA synthetase

SCOP Domain Sequences for d1g59a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g59a2 c.26.1.1 (A:1-305) Glutamyl-tRNA synthetase (GluRS) {Thermus thermophilus [TaxId: 274]}
mvvtriapsptgdphvgtayialfnyawarrnggrfivriedtdraryvpgaeerilaal
kwlglsydegpdvaaptgpyrqserlplyqkyaeellkrgwayrafetpeeleqirkekg
gydgrarnippeeaeerarrgephvirlkvprpgttevkdelrgvvvydnqeipdvvllk
sdgyptyhlanvvddhlmgvtdviraeewlvstpihvllyrafgweaprfyhmpllrnpd
ktkiskrkshtsldwykaegflpealrnylclmgfsmpdgreiftleefiqaftwervsl
ggpvf

SCOP Domain Coordinates for d1g59a2:

Click to download the PDB-style file with coordinates for d1g59a2.
(The format of our PDB-style files is described here.)

Timeline for d1g59a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1g59a1