SCOPe 2.05: Domain d1g59a1: 1g59 A:306-468

Lineage for d1g59a1 (1g59 A:306-468)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.97: An anticodon-binding domain of class I aminoacyl-tRNA synthetases [48162] (1 superfamily)
   multihelical; consists of two all-alpha domains

4. Superfamily a.97.1: An anticodon-binding domain of class I aminoacyl-tRNA synthetases [48163] (3 families)

5. Family a.97.1.1: C-terminal domain of glutamyl-tRNA synthetase (GluRS) [48164] (1 protein)

6. Protein C-terminal domain of glutamyl-tRNA synthetase (GluRS) [48165] (1 species)

7. Species Thermus thermophilus [TaxId:274] [48166] (11 PDB entries)

8. Domain d1g59a1: 1g59 A:306-468 [60257]
   Other proteins in same PDB: d1g59a2, d1g59c2
   protein/RNA complex

Details for d1g59a1

PDB Entry: 1g59, 2.4 Å

PDB Description: glutamyl-trna synthetase complexed with trna(glu).

PDB Compounds: (A:) Glutamyl-tRNA synthetase

SCOPe Domain Sequences for d1g59a1:

Sequence; same for both SEQRES and ATOM records:

>d1g59a1 a.97.1.1 (A:306-468) C-terminal domain of glutamyl-tRNA synthetase (GluRS) {Thermus thermophilus [TaxId: 274]}
dleklrwmngkyirevlsleevaervkpflreaglsweseaylrravelmrprfdtlkef
pekarylftedypvsekaqrkleeglpllkelyprlraqeewteaaleallrgfaaekgv
klgqvaqplraaltgsletpglfeilallgkeralrrlerala

Timeline for d1g59a1:

• d1g59a1 first appeared in SCOP 1.57
  
• d1g59a1 appears in SCOPe 2.04
  
• d1g59a1 appears in SCOPe 2.06
  
• d1g59a1 appears in the current release, SCOPe 2.08