Lineage for d1g58b_ (1g58 B:)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 136919Fold d.115: YrdC/RibB [55820] (1 superfamily)
  4. 136920Superfamily d.115.1: YrdC/RibB [55821] (2 families) (S)
  5. 136926Family d.115.1.2: 3,4-dihydroxy-2-butanone 4-phosphate synthase, DHBP synthase, RibB [64372] (1 protein)
  6. 136927Protein 3,4-dihydroxy-2-butanone 4-phosphate synthase, DHBP synthase, RibB [64373] (1 species)
  7. 136928Species Escherichia coli [TaxId:562] [64374] (3 PDB entries)
  8. 136932Domain d1g58b_: 1g58 B: [60256]

Details for d1g58b_

PDB Entry: 1g58 (more details), 1.55 Å

PDB Description: crystal structure of 3,4-dihydroxy-2-butanone 4-phosphate synthase gold derivative

SCOP Domain Sequences for d1g58b_:

Sequence, based on SEQRES records: (download)

>d1g58b_ d.115.1.2 (B:) 3,4-dihydroxy-2-butanone 4-phosphate synthase, DHBP synthase, RibB {Escherichia coli}
tllssfgtpfervenalaalregrgvmvlddedrenegdmifpaetmtveqmaltirhgs
givclcitedrrkqldlpmmvenntsaygtgftvtieaaegvttgvsaadrittvraaia
dgakpsdlnrpghvfplraqaggvltrgghteatidlmtlagfkpagvlceltnddgtma
rapeciefankhnmalvtiedlvayrqah

Sequence, based on observed residues (ATOM records): (download)

>d1g58b_ d.115.1.2 (B:) 3,4-dihydroxy-2-butanone 4-phosphate synthase, DHBP synthase, RibB {Escherichia coli}
tllssfgtpfervenalaalregrgvmvldnegdmifpaetmtveqmaltirhgsgivcl
citedrrkqldlpmmvegftvtieaaegvttgvsaadrittvraaiadgakpsdlnrpgh
vfplraqaggvltrgghteatidlmtlagfkpagvlceltnddgtmarapeciefankhn
malvtiedlvayrqah

SCOP Domain Coordinates for d1g58b_:

Click to download the PDB-style file with coordinates for d1g58b_.
(The format of our PDB-style files is described here.)

Timeline for d1g58b_: