Lineage for d1g58b_ (1g58 B:)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 83343Fold d.115: YrdC/RibB [55820] (1 superfamily)
  4. 83344Superfamily d.115.1: YrdC/RibB [55821] (2 families) (S)
  5. 83350Family d.115.1.2: 3,4-dihydroxy-2-butanone 4-phosphate synthase, DHBP synthase, RibB [64372] (1 protein)
  6. 83351Protein 3,4-dihydroxy-2-butanone 4-phosphate synthase, DHBP synthase, RibB [64373] (1 species)
  7. 83352Species Escherichia coli [TaxId:562] [64374] (2 PDB entries)
  8. 83356Domain d1g58b_: 1g58 B: [60256]

Details for d1g58b_

PDB Entry: 1g58 (more details), 1.55 Å

PDB Description: crystal structure of 3,4-dihydroxy-2-butanone 4-phosphate synthase gold derivative

SCOP Domain Sequences for d1g58b_:

Sequence, based on SEQRES records: (download)

>d1g58b_ d.115.1.2 (B:) 3,4-dihydroxy-2-butanone 4-phosphate synthase, DHBP synthase, RibB {Escherichia coli}
tllssfgtpfervenalaalregrgvmvlddedrenegdmifpaetmtveqmaltirhgs
givclcitedrrkqldlpmmvenntsaygtgftvtieaaegvttgvsaadrittvraaia
dgakpsdlnrpghvfplraqaggvltrgghteatidlmtlagfkpagvlceltnddgtma
rapeciefankhnmalvtiedlvayrqah

Sequence, based on observed residues (ATOM records): (download)

>d1g58b_ d.115.1.2 (B:) 3,4-dihydroxy-2-butanone 4-phosphate synthase, DHBP synthase, RibB {Escherichia coli}
tllssfgtpfervenalaalregrgvmvldnegdmifpaetmtveqmaltirhgsgivcl
citedrrkqldlpmmvegftvtieaaegvttgvsaadrittvraaiadgakpsdlnrpgh
vfplraqaggvltrgghteatidlmtlagfkpagvlceltnddgtmarapeciefankhn
malvtiedlvayrqah

SCOP Domain Coordinates for d1g58b_:

Click to download the PDB-style file with coordinates for d1g58b_.
(The format of our PDB-style files is described here.)

Timeline for d1g58b_: