Lineage for d1g57b_ (1g57 B:)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 871336Fold d.115: YrdC/RibB [55820] (1 superfamily)
    core: alpha-beta(2)-alpha-beta-alpha(2)-beta(2)-alpha-beta-alpha-beta; 3 layers; mixed twisted sheet of 7 strands; order 7126354; strands 7 and 1 are parallel to each other
  4. 871337Superfamily d.115.1: YrdC/RibB [55821] (2 families) (S)
  5. 871350Family d.115.1.2: 3,4-dihydroxy-2-butanone 4-phosphate synthase, DHBP synthase, RibB [64372] (1 protein)
    contains one additional helix in the C-terminal extension
  6. 871351Protein 3,4-dihydroxy-2-butanone 4-phosphate synthase, DHBP synthase, RibB [64373] (4 species)
  7. 871367Species Escherichia coli [TaxId:562] [64374] (3 PDB entries)
  8. 871369Domain d1g57b_: 1g57 B: [60254]
    complexed with cs

Details for d1g57b_

PDB Entry: 1g57 (more details), 1.4 Å

PDB Description: crystal structure of 3,4-dihydroxy-2-butanone 4-phosphate synthase
PDB Compounds: (B:) 3,4-dihydroxy-2-butanone 4-phosphate synthase

SCOP Domain Sequences for d1g57b_:

Sequence, based on SEQRES records: (download)

>d1g57b_ d.115.1.2 (B:) 3,4-dihydroxy-2-butanone 4-phosphate synthase, DHBP synthase, RibB {Escherichia coli [TaxId: 562]}
tllssfgtpfervenalaalregrgvmvlddedrenegdmifpaetmtveqmaltirhgs
givclcitedrrkqldlpmmvenntsaygtgftvtieaaegvttgvsaadrittvraaia
dgakpsdlnrpghvfplraqaggvltrgghteatidlmtlagfkpagvlceltnddgtma
rapeciefankhnmalvtiedlvayrqaherkas

Sequence, based on observed residues (ATOM records): (download)

>d1g57b_ d.115.1.2 (B:) 3,4-dihydroxy-2-butanone 4-phosphate synthase, DHBP synthase, RibB {Escherichia coli [TaxId: 562]}
tllssfgtpfervenalaalregrgvmvldnegdmifpaetmtveqmaltirhgsgivcl
citedrrkqldlpmmvenntsaygtgftvtieaaegvttgvsaadrittvraaiadgakp
sdlnrpghvfplraqaggvltrgghteatidlmtlagfkpagvlceltnddgtmarapec
iefankhnmalvtiedlvayrqaherkas

SCOP Domain Coordinates for d1g57b_:

Click to download the PDB-style file with coordinates for d1g57b_.
(The format of our PDB-style files is described here.)

Timeline for d1g57b_: