Lineage for d1g57a_ (1g57 A:)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 195933Fold d.115: YrdC/RibB [55820] (1 superfamily)
  4. 195934Superfamily d.115.1: YrdC/RibB [55821] (2 families) (S)
  5. 195946Family d.115.1.2: 3,4-dihydroxy-2-butanone 4-phosphate synthase, DHBP synthase, RibB [64372] (1 protein)
  6. 195947Protein 3,4-dihydroxy-2-butanone 4-phosphate synthase, DHBP synthase, RibB [64373] (2 species)
  7. 195948Species Escherichia coli [TaxId:562] [64374] (3 PDB entries)
  8. 195949Domain d1g57a_: 1g57 A: [60253]

Details for d1g57a_

PDB Entry: 1g57 (more details), 1.4 Å

PDB Description: crystal structure of 3,4-dihydroxy-2-butanone 4-phosphate synthase

SCOP Domain Sequences for d1g57a_:

Sequence, based on SEQRES records: (download)

>d1g57a_ d.115.1.2 (A:) 3,4-dihydroxy-2-butanone 4-phosphate synthase, DHBP synthase, RibB {Escherichia coli}
llssfgtpfervenalaalregrgvmvlddedrenegdmifpaetmtveqmaltirhgsg
ivclcitedrrkqldlpmmvenntsaygtgftvtieaaegvttgvsaadrittvraaiad
gakpsdlnrpghvfplraqaggvltrgghteatidlmtlagfkpagvlceltnddgtmar
apeciefankhnmalvtiedlvayrqahe

Sequence, based on observed residues (ATOM records): (download)

>d1g57a_ d.115.1.2 (A:) 3,4-dihydroxy-2-butanone 4-phosphate synthase, DHBP synthase, RibB {Escherichia coli}
llssfgtpfervenalaalregrgvmvldenegdmifpaetmtveqmaltirhgsgivcl
citedrrkqldlpmmvenntsaygtgftvtieaaegvttgvsaadrittvraaiadgakp
sdlnrpghvfplraqaggvltrgghteatidlmtlagfkpagvlceltnddgtmarapec
iefankhnmalvtiedlvayrqahe

SCOP Domain Coordinates for d1g57a_:

Click to download the PDB-style file with coordinates for d1g57a_.
(The format of our PDB-style files is described here.)

Timeline for d1g57a_: