SCOPe 2.07: Domain d1g4yb1: 1g4y B:413-488

Lineage for d1g4yb1 (1g4y B:413-488)

1. Root: SCOPe 2.07

2. Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)

3. Fold f.15: Small-conductance potassium channel [81328] (1 superfamily)
   oligomeric transmembrane alpha-helical protein

4. Superfamily f.15.1: Small-conductance potassium channel [81327] (1 family)

5. Family f.15.1.1: Small-conductance potassium channel [81326] (1 protein)

6. Protein Small-conductance potassium channel [64528] (2 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [64529] (8 PDB entries)

8. Domain d1g4yb1: 1g4y B:413-488 [60251]
   Other proteins in same PDB: d1g4yb2, d1g4yr_
   gating domain in complex with calmodulin
   complexed with ca, so4

Details for d1g4yb1

PDB Entry: 1g4y, 1.6 Å

PDB Description: 1.60 a crystal structure of the gating domain from small conductance potassium channel complexed with calcium-calmodulin

PDB Compounds: (B:) calcium-activated potassium channel rsk2

SCOPe Domain Sequences for d1g4yb1:

Sequence; same for both SEQRES and ATOM records:

>d1g4yb1 f.15.1.1 (B:413-488) Small-conductance potassium channel {Norway rat (Rattus norvegicus) [TaxId: 10116]}
dtqltkrvknaaanvlretwliykntklvkkidhakvrkhqrkflqaihqlrsvkmeqrk
lndqantlvdlaktql

Timeline for d1g4yb1:

• d1g4yb1 first appeared in SCOP 1.57, called d1g4yb_
  
• d1g4yb1 appears in SCOPe 2.06
  
• d1g4yb1 appears in the current release, SCOPe 2.08