SCOP 1.73: Domain d1g4yb_: 1g4y B:

Lineage for d1g4yb_ (1g4y B:)

1. Root: SCOP 1.73

2. Class f: Membrane and cell surface proteins and peptides [56835] (50 folds)

3. Fold f.15: Small-conductance potassium channel [81328] (1 superfamily)
   oligomeric transmembrane alpha-helical protein

4. Superfamily f.15.1: Small-conductance potassium channel [81327] (1 family)

5. Family f.15.1.1: Small-conductance potassium channel [81326] (1 protein)

6. Protein Small-conductance potassium channel [64528] (1 species)

7. Species Rat (Rattus norvegicus) [TaxId:10116] [64529] (2 PDB entries)

8. Domain d1g4yb_: 1g4y B: [60251]
   Other proteins in same PDB: d1g4yr_
   gating domain in complex with calmodulin
   complexed with ca, so4

Details for d1g4yb_

PDB Entry: 1g4y, 1.6 Å

PDB Description: 1.60 a crystal structure of the gating domain from small conductance potassium channel complexed with calcium-calmodulin

PDB Compounds: (B:) calcium-activated potassium channel rsk2

SCOP Domain Sequences for d1g4yb_:

Sequence, based on SEQRES records:

>d1g4yb_ f.15.1.1 (B:) Small-conductance potassium channel {Rat (Rattus norvegicus) [TaxId: 10116]}
dtqltkrvknaaanvlretwliykntklvkkidhakvrkhqrkflqaihqlrsvkmeqrk
lndqantlvdlaktqlehhhhh

Sequence, based on observed residues (ATOM records):

>d1g4yb_ f.15.1.1 (B:) Small-conductance potassium channel {Rat (Rattus norvegicus) [TaxId: 10116]}
dtqltkrvknaaanvlretwliykntklvkkidhakvrkhqrkflqaihqlrsvkmeqrk
lndqantlvdlaktqlhhhhh

Timeline for d1g4yb_:

• d1g4yb_ first appeared in SCOP 1.57
  
• d1g4yb_ appears in SCOP 1.71
  
• d1g4yb_ appears in SCOP 1.75
  
• d1g4yb_ appears in the current release, SCOPe 2.08, called d1g4yb1