SCOP 1.61: Domain d1g4yb_: 1g4y B:

Lineage for d1g4yb_ (1g4y B:)

1. Root: SCOP 1.61

2. Class f: Membrane and cell surface proteins and peptides [56835] (12 folds)

3. Fold f.2: Membrane all-alpha [56868] (1 superfamily)

4. Superfamily f.2.1: Membrane all-alpha [56869] (13 families)

5. Family f.2.1.11: Oligomeric gated channels [63383] (4 proteins)

6. Protein Small conductance potassium channel [64528] (1 species)

7. Species Rat (Rattus norvegicus) [TaxId:10116] [64529] (2 PDB entries)

8. Domain d1g4yb_: 1g4y B: [60251]
   Other proteins in same PDB: d1g4yr_

Details for d1g4yb_

PDB Entry: 1g4y, 1.6 Å

PDB Description: 1.60 a crystal structure of the gating domain from small conductance potassium channel complexed with calcium-calmodulin

SCOP Domain Sequences for d1g4yb_:

Sequence, based on SEQRES records:

>d1g4yb_ f.2.1.11 (B:) Small conductance potassium channel {Rat (Rattus norvegicus)}
dtqltkrvknaaanvlretwliykntklvkkidhakvrkhqrkflqaihqlrsvkmeqrk
lndqantlvdlaktqlehhhhh

Sequence, based on observed residues (ATOM records):

>d1g4yb_ f.2.1.11 (B:) Small conductance potassium channel {Rat (Rattus norvegicus)}
dtqltkrvknaaanvlretwliykntklvkkidhakvrkhqrkflqaihqlrsvkmeqrk
lndqantlvdlaktqlhhhhh

Timeline for d1g4yb_:

• d1g4yb_ first appeared in SCOP 1.57
  
• d1g4yb_ appears in SCOP 1.59
  
• d1g4yb_ appears in SCOP 1.63
  
• d1g4yb_ appears in the current release, SCOPe 2.08, called d1g4yb1