Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.3: Thiamin phosphate synthase [51391] (2 families) automatically mapped to Pfam PF02581 |
Family c.1.3.1: Thiamin phosphate synthase [51392] (2 proteins) |
Protein Thiamin phosphate synthase [51393] (2 species) |
Species Bacillus subtilis [TaxId:1423] [51394] (9 PDB entries) |
Domain d1g4tb_: 1g4t B: [60250] complexed with ftp, mg, pop |
PDB Entry: 1g4t (more details), 1.55 Å
SCOPe Domain Sequences for d1g4tb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1g4tb_ c.1.3.1 (B:) Thiamin phosphate synthase {Bacillus subtilis [TaxId: 1423]} hhgirmtrisremmkellsvyfimgsnntkadpvtvvqkalkggatlyqfrekggdaltg earikfaekaqaacreagvpfivnddvelalnlkadgihigqedanakevraaigdmilg vsahtmsevkqaeedgadyvglgpiyptetkkdtravqgvslieavrrqgisipivgigg itidnaapviqagadgvsmisaisqaedpesaarkfreeiqtyktgr
Timeline for d1g4tb_: