SCOPe 2.07: Domain d1g4sb1: 1g4s B:1014-1235

Lineage for d1g4sb1 (1g4s B:1014-1235)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.3: Thiamin phosphate synthase [51391] (2 families)
   automatically mapped to Pfam PF02581

5. Family c.1.3.1: Thiamin phosphate synthase [51392] (2 proteins)

6. Protein Thiamin phosphate synthase [51393] (2 species)

7. Species Bacillus subtilis [TaxId:1423] [51394] (9 PDB entries)

8. Domain d1g4sb1: 1g4s B:1014-1235 [60248]
   Other proteins in same PDB: d1g4sa2, d1g4sb2
   complexed with mg, pop, tps

Details for d1g4sb1

PDB Entry: 1g4s, 1.7 Å

PDB Description: thiamin phosphate synthase

PDB Compounds: (B:) thiamin phosphate synthase

SCOPe Domain Sequences for d1g4sb1:

Sequence; same for both SEQRES and ATOM records:

>d1g4sb1 c.1.3.1 (B:1014-1235) Thiamin phosphate synthase {Bacillus subtilis [TaxId: 1423]}
mtrisremmkellsvyfimgsnntkadpvtvvqkalkggatlyqfrekggdaltgearik
faekaqaacreagvpfivnddvelalnlkadgihigqedanakevraaigdmilgvaaht
msevkqaeedgadyvglgpiyptetkkdtravqgvslieavrrqgisipivgiggitidn
aapviqagadgvsmisaisqaedpesaarkfreeiqtyktgr

Timeline for d1g4sb1:

• d1g4sb1 first appeared in SCOP 1.57, called d1g4sb_
  
• d1g4sb1 appears in SCOPe 2.06
  
• d1g4sb1 appears in the current release, SCOPe 2.08