Lineage for d1g4pb_ (1g4p B:)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 64292Fold c.1: TIM beta/alpha-barrel [51350] (24 superfamilies)
  4. 64517Superfamily c.1.3: Thiamin phosphate synthase [51391] (1 family) (S)
  5. 64518Family c.1.3.1: Thiamin phosphate synthase [51392] (1 protein)
  6. 64519Protein Thiamin phosphate synthase [51393] (1 species)
  7. 64520Species Bacillus subtilis [TaxId:1423] [51394] (8 PDB entries)
  8. 64536Domain d1g4pb_: 1g4p B: [60246]

Details for d1g4pb_

PDB Entry: 1g4p (more details), 2.5 Å

PDB Description: thiamin phosphate synthase

SCOP Domain Sequences for d1g4pb_:

Sequence, based on SEQRES records: (download)

>d1g4pb_ c.1.3.1 (B:) Thiamin phosphate synthase {Bacillus subtilis}
hgirmtrisremmkellsvyfimgsnntkadpvtvvqkalkggatlyqfrekggdaltge
arikfaekaqaacreagvpfivnddvelalnlkadgihigqedanakevraaigdmilgv
aahtmsevkqaeedgadyvglgpiyptetkkdtravqgvslieavrrqgisipivgiggi
tidnaapviqagadgvsmisaisqaedpesaarkfreeiqtyktgr

Sequence, based on observed residues (ATOM records): (download)

>d1g4pb_ c.1.3.1 (B:) Thiamin phosphate synthase {Bacillus subtilis}
hgirmtrisremmkellsvyfimgsnntkadpvtvvqkalkggatlyqfrekggdaltge
arikfaekaqaacreagvpfivnddvelalnlkadgihigqedanakevraaigdmilgv
aahtmsevkqaeedgadyvglgpiypravqgvslieavrrqgisipivgiggitidnaap
viqagadgvsmisaisqaedpesaarkfreeiqtyktgr

SCOP Domain Coordinates for d1g4pb_:

Click to download the PDB-style file with coordinates for d1g4pb_.
(The format of our PDB-style files is described here.)

Timeline for d1g4pb_: