Class d: Alpha and beta proteins (a+b) [53931] (194 folds) |
Fold d.92: Zincin-like [55485] (2 superfamilies) |
Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (13 families) |
Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (8 proteins) |
Protein Stromelysin-1 (MMP-3) [55536] (1 species) |
Species Human (Homo sapiens), fibroblast [TaxId:9606] [55537] (25 PDB entries) |
Domain d1g4ka_: 1g4k A: [60242] |
PDB Entry: 1g4k (more details), 2 Å
SCOP Domain Sequences for d1g4ka_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1g4ka_ d.92.1.11 (A:) Stromelysin-1 (MMP-3) {Human (Homo sapiens), fibroblast} frtfpgipkwrkthltyrivnytpdlpkdavdsavekalkvweevtpltfsrlyegeadi misfavrehgdfypfdgpgnvlahayapgpgingdahfdddeqwtkdttgtnlflvaahe ighslglfhsantealmyplyhsltdltrfrlsqddingiqslygppp
Timeline for d1g4ka_: