SCOPe 2.05: Domain d1g4ea_: 1g4e A:

Lineage for d1g4ea_ (1g4e A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.3: Thiamin phosphate synthase [51391] (2 families)
   automatically mapped to Pfam PF02581

5. Family c.1.3.1: Thiamin phosphate synthase [51392] (2 proteins)

6. Protein Thiamin phosphate synthase [51393] (2 species)

7. Species Bacillus subtilis [TaxId:1423] [51394] (9 PDB entries)

8. Domain d1g4ea_: 1g4e A: [60239]

Details for d1g4ea_

PDB Entry: 1g4e, 1.6 Å

PDB Description: thiamin phosphate synthase

PDB Compounds: (A:) thiamin phosphate synthase

SCOPe Domain Sequences for d1g4ea_:

Sequence, based on SEQRES records:

>d1g4ea_ c.1.3.1 (A:) Thiamin phosphate synthase {Bacillus subtilis [TaxId: 1423]}
hgirmtrisremmkellsvyfimgsnntkadpvtvvqkalkggatlyqfrekggdaltge
arikfaekaqaacreagvpfivnddvelalnlkadgihigqedanakevraaigdmilgv
aahtmsevkqaeedgadyvglgpiyptetkkdtravqgvslieavrrqgisipivgiggi
tidnaapviqagadgvsmisaisqaedpesaarkfreeiqtyktgr

Sequence, based on observed residues (ATOM records):

>d1g4ea_ c.1.3.1 (A:) Thiamin phosphate synthase {Bacillus subtilis [TaxId: 1423]}
hgirmtrisremmkellsvyfimgsnntkadpvtvvqkalkggatlyqfrekggdaltge
arikfaekaqaacreagvpfivnddvelalnlkadgihigqanakevraaigdmilgvaa
htmsevkqaeedgadyvglgpiypttravqgvslieavrrqgisipivgiggitidnaap
viqagadgvsmisaisqaedpesaarkfreeiqtyktgr

Timeline for d1g4ea_:

• d1g4ea_ first appeared in SCOP 1.57
  
• d1g4ea_ appears in SCOPe 2.04
  
• d1g4ea_ is called d1g4ea1 in SCOPe 2.06
  
• d1g4ea_ appears in the current release, SCOPe 2.08, called d1g4ea1