Lineage for d1g3ra_ (1g3r A:)
- Root: SCOP 1.57
Class c: Alpha and beta proteins (a/b) [51349] (107 folds) 
Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily) Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (15 families) 
Family c.37.1.10: Nitrogenase iron protein-like [52652] (8 proteins) 
Protein Cell division regulator MinD [64019] (3 species) Species Archaeon Pyrococcus furiosus [TaxId:2261] [64021] (2 PDB entries) 
Domain d1g3ra_: 1g3r A: [60238]
Details for d1g3ra_
PDB Entry: 1g3r (more details), 2.7 Å
PDB Description: crystal structure analysis of pyrococcus furiosus cell division atpase mind
SCOP Domain Sequences for d1g3ra_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1g3ra_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Pyrococcus furiosus}
mgriisivsgkggtgkttvtanlsvalgdrgrkvlavdgdltmanlslvlgvddpdvtlh
dvlageanvedaiymtqfdnvyvlpgavdwehvlkadprklpevikslkdkfdfilidcp
aglqldamsamlsgeeallvtnpeiscltdtmkvgivlkkaglailgfvlnrygrsdrdi
ppeaaedvmevpllavipedpairegtlegipavkykpeskgakafvklaeeiekla
SCOP Domain Coordinates for d1g3ra_:
Click to download the PDB-style file with coordinates for d1g3ra_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1g3ra_:
- d1g3ra_ is new in SCOP 1.57
- d1g3ra_ appears in SCOP 1.59
- d1g3ra_ appears in the current release, SCOPe 2.08
View in 3D