Lineage for d1g3ra_ (1g3r A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2446887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2446888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2449617Family c.37.1.10: Nitrogenase iron protein-like [52652] (16 protein domains)
    core: parallel beta-sheet of 7 strands; order 3241567
  6. 2449693Protein Cell division regulator MinD [64019] (3 species)
  7. 2449696Species Pyrococcus furiosus [TaxId:2261] [64021] (2 PDB entries)
  8. 2449698Domain d1g3ra_: 1g3r A: [60238]
    complexed with acp, mg

Details for d1g3ra_

PDB Entry: 1g3r (more details), 2.7 Å

PDB Description: crystal structure analysis of pyrococcus furiosus cell division atpase mind
PDB Compounds: (A:) cell division inhibitor

SCOPe Domain Sequences for d1g3ra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g3ra_ c.37.1.10 (A:) Cell division regulator MinD {Pyrococcus furiosus [TaxId: 2261]}
mgriisivsgkggtgkttvtanlsvalgdrgrkvlavdgdltmanlslvlgvddpdvtlh
dvlageanvedaiymtqfdnvyvlpgavdwehvlkadprklpevikslkdkfdfilidcp
aglqldamsamlsgeeallvtnpeiscltdtmkvgivlkkaglailgfvlnrygrsdrdi
ppeaaedvmevpllavipedpairegtlegipavkykpeskgakafvklaeeiekla

SCOPe Domain Coordinates for d1g3ra_:

Click to download the PDB-style file with coordinates for d1g3ra_.
(The format of our PDB-style files is described here.)

Timeline for d1g3ra_: