Lineage for d1g2oc_ (1g2o C:)
- Root: SCOP 1.57
Class c: Alpha and beta proteins (a/b) [51349] (107 folds) 
Fold c.56: Phosphorylase/hydrolase-like [53162] (6 superfamilies) 
Superfamily c.56.2: Purine and uridine phosphorylases [53167] (1 family) 
Family c.56.2.1: Purine and uridine phosphorylases [53168] (3 proteins) Protein Purine nucleoside phosphorylase, PNP [53169] (5 species) 
Species Mycobacterium tuberculosis [TaxId:1773] [64098] (2 PDB entries) 
Domain d1g2oc_: 1g2o C: [60230]
Details for d1g2oc_
PDB Entry: 1g2o (more details), 1.75 Å
PDB Description: crystal structure of purine nucleoside phosphorylase from mycobacterium tuberculosis in complex with a transition-state inhibitor
SCOP Domain Sequences for d1g2oc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1g2oc_ c.56.2.1 (C:) Purine nucleoside phosphorylase, PNP {Mycobacterium tuberculosis}
dpdelarraaqviadrtgigehdvavvlgsgwlpavaalgspttvlpqaelpgfvpptaa
ghagellsvpigahrvlvlagrihayeghdlryvvhpvraaraagaqimvltnaagglra
dlqvgqpvlisdhlnltarsplvggefvdltdaysprlrelarqsdpqlaegvyaglpgp
hyetpaeirmlqtlgadlvgmstvhetiaaraagaevlgvslvtnlaagitgeplshaev
laagaasatrmgalladviarf
SCOP Domain Coordinates for d1g2oc_:
Click to download the PDB-style file with coordinates for d1g2oc_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1g2oc_:
- d1g2oc_ is new in SCOP 1.57
- d1g2oc_ appears in SCOP 1.59
- d1g2oc_ appears in the current release, SCOPe 2.08
View in 3D
