Lineage for d1g2ob_ (1g2o B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2887810Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 2887827Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) (S)
    complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8
  5. 2887828Family c.56.2.1: Purine and uridine phosphorylases [53168] (7 proteins)
  6. 2887952Protein Purine nucleoside phosphorylase, PNP [53169] (14 species)
  7. 2888201Species Mycobacterium tuberculosis [TaxId:1773] [64098] (3 PDB entries)
  8. 2888203Domain d1g2ob_: 1g2o B: [60229]
    complexed with imh, po4

Details for d1g2ob_

PDB Entry: 1g2o (more details), 1.75 Å

PDB Description: crystal structure of purine nucleoside phosphorylase from mycobacterium tuberculosis in complex with a transition-state inhibitor
PDB Compounds: (B:) purine nucleoside phosphorylase

SCOPe Domain Sequences for d1g2ob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g2ob_ c.56.2.1 (B:) Purine nucleoside phosphorylase, PNP {Mycobacterium tuberculosis [TaxId: 1773]}
dpdelarraaqviadrtgigehdvavvlgsgwlpavaalgspttvlpqaelpgfvpptaa
ghagellsvpigahrvlvlagrihayeghdlryvvhpvraaraagaqimvltnaagglra
dlqvgqpvlisdhlnltarsplvggefvdltdaysprlrelarqsdpqlaegvyaglpgp
hyetpaeirmlqtlgadlvgmstvhetiaaraagaevlgvslvtnlaagitgeplshaev
laagaasatrmgalladviarf

SCOPe Domain Coordinates for d1g2ob_:

Click to download the PDB-style file with coordinates for d1g2ob_.
(The format of our PDB-style files is described here.)

Timeline for d1g2ob_: