Class a: All alpha proteins [46456] (286 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.1: Homeodomain-like [46689] (20 families) consists only of helices |
Family a.4.1.12: FIS-like [100918] (4 proteins) |
Protein Transcriptional regulator TyrR, C-terminal domain [63470] (1 species) |
Species Haemophilus influenzae [TaxId:727] [63471] (1 PDB entry) |
Domain d1g2ha_: 1g2h A: [60224] |
PDB Entry: 1g2h (more details)
SCOPe Domain Sequences for d1g2ha_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1g2ha_ a.4.1.12 (A:) Transcriptional regulator TyrR, C-terminal domain {Haemophilus influenzae [TaxId: 727]} savisldefenktldeiigfyeaqvlklfyaeypstrklaqrlgvshtaianklkqygig k
Timeline for d1g2ha_: