Lineage for d1g2ha_ (1g2h A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1720410Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1720411Superfamily a.4.1: Homeodomain-like [46689] (20 families) (S)
    consists only of helices
  5. 1721119Family a.4.1.12: FIS-like [100918] (4 proteins)
  6. 1721186Protein Transcriptional regulator TyrR, C-terminal domain [63470] (1 species)
  7. 1721187Species Haemophilus influenzae [TaxId:727] [63471] (1 PDB entry)
  8. 1721188Domain d1g2ha_: 1g2h A: [60224]

Details for d1g2ha_

PDB Entry: 1g2h (more details)

PDB Description: solution structure of the dna-binding domain of the tyrr protein of haemophilus influenzae
PDB Compounds: (A:) transcriptional regulatory protein tyrr homolog

SCOPe Domain Sequences for d1g2ha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g2ha_ a.4.1.12 (A:) Transcriptional regulator TyrR, C-terminal domain {Haemophilus influenzae [TaxId: 727]}
savisldefenktldeiigfyeaqvlklfyaeypstrklaqrlgvshtaianklkqygig
k

SCOPe Domain Coordinates for d1g2ha_:

Click to download the PDB-style file with coordinates for d1g2ha_.
(The format of our PDB-style files is described here.)

Timeline for d1g2ha_: