Lineage for d1g2ff_ (1g2f F:)
- Root: SCOP 1.59
Class k: Designed proteins [58788] (31 folds) 
Fold k.12: Zinc finger design [58856] (1 superfamily) Superfamily k.12.1: Zinc finger design [58857] (1 family) 
Family k.12.1.1: Zinc finger design [58858] (4 proteins) Protein TATA box-binding zinc finger, TATAZF [64671] (1 species) Species Mouse (Mus musculus), Zif268 based [TaxId:10090] [64672] (2 PDB entries) 
Domain d1g2ff_: 1g2f F: [60223]
Details for d1g2ff_
PDB Entry: 1g2f (more details), 2 Å
PDB Description: structure of a cys2his2 zinc finger/tata box complex (tatazf;clone #6)
SCOP Domain Sequences for d1g2ff_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1g2ff_ k.12.1.1 (F:) TATA box-binding zinc finger, TATAZF {Mouse (Mus musculus), Zif268 based}
erpyacpvescdrrfsqktnldthirihtgqkpfqcricmrnfsqqaslnahirthtgek
pfacdicgrkfatlhtrtrhtkihlrq
SCOP Domain Coordinates for d1g2ff_:
Click to download the PDB-style file with coordinates for d1g2ff_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1g2ff_:
- d1g2ff_ first appeared in SCOP 1.57
- d1g2ff_ appears in SCOP 1.61
- d1g2ff_ appears in the current release, SCOPe 2.08
View in 3D
