Lineage for d1g2ff_ (1g2f F:)

  1. Root: SCOPe 2.08
  2. 3047812Class k: Designed proteins [58788] (44 folds)
  3. 3048037Fold k.12: Zinc finger design [58856] (1 superfamily)
  4. 3048038Superfamily k.12.1: Zinc finger design [58857] (1 family) (S)
  5. 3048039Family k.12.1.1: Zinc finger design [58858] (7 proteins)
  6. 3048060Protein TATA box-binding zinc finger, TATAZF [64671] (1 species)
  7. 3048061Species Mouse (Mus musculus), Zif268 based [TaxId:10090] [64672] (2 PDB entries)
  8. 3048063Domain d1g2ff_: 1g2f F: [60223]
    clone 6
    protein/DNA complex; complexed with zn

Details for d1g2ff_

PDB Entry: 1g2f (more details), 2 Å

PDB Description: structure of a cys2his2 zinc finger/tata box complex (tatazf;clone #6)
PDB Compounds: (F:) tata box zinc finger protein

SCOPe Domain Sequences for d1g2ff_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g2ff_ k.12.1.1 (F:) TATA box-binding zinc finger, TATAZF {Mouse (Mus musculus), Zif268 based [TaxId: 10090]}
erpyacpvescdrrfsqktnldthirihtgqkpfqcricmrnfsqqaslnahirthtgek
pfacdicgrkfatlhtrtrhtkihlrq

SCOPe Domain Coordinates for d1g2ff_:

Click to download the PDB-style file with coordinates for d1g2ff_.
(The format of our PDB-style files is described here.)

Timeline for d1g2ff_: