Lineage for d1g2fc_ (1g2f C:)

  1. Root: SCOPe 2.06
  2. 2273425Class k: Designed proteins [58788] (44 folds)
  3. 2273650Fold k.12: Zinc finger design [58856] (1 superfamily)
  4. 2273651Superfamily k.12.1: Zinc finger design [58857] (1 family) (S)
  5. 2273652Family k.12.1.1: Zinc finger design [58858] (7 proteins)
  6. 2273673Protein TATA box-binding zinc finger, TATAZF [64671] (1 species)
  7. 2273674Species Mouse (Mus musculus), Zif268 based [TaxId:10090] [64672] (2 PDB entries)
  8. 2273675Domain d1g2fc_: 1g2f C: [60222]
    clone 6
    protein/DNA complex; complexed with zn

Details for d1g2fc_

PDB Entry: 1g2f (more details), 2 Å

PDB Description: structure of a cys2his2 zinc finger/tata box complex (tatazf;clone #6)
PDB Compounds: (C:) tata box zinc finger protein

SCOPe Domain Sequences for d1g2fc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g2fc_ k.12.1.1 (C:) TATA box-binding zinc finger, TATAZF {Mouse (Mus musculus), Zif268 based [TaxId: 10090]}
merpyacpvescdrrfsqktnldthirihtgqkpfqcricmrnfsqqaslnahirthtge
kpfacdicgrkfatlhtrtrhtkihlrqk

SCOPe Domain Coordinates for d1g2fc_:

Click to download the PDB-style file with coordinates for d1g2fc_.
(The format of our PDB-style files is described here.)

Timeline for d1g2fc_: