Lineage for d1g2df_ (1g2d F:)

  1. Root: SCOP 1.73
  2. 757717Class k: Designed proteins [58788] (44 folds)
  3. 757938Fold k.12: Zinc finger design [58856] (1 superfamily)
  4. 757939Superfamily k.12.1: Zinc finger design [58857] (1 family) (S)
  5. 757940Family k.12.1.1: Zinc finger design [58858] (6 proteins)
  6. 757957Protein TATA box-binding zinc finger, TATAZF [64671] (1 species)
  7. 757958Species Mouse (Mus musculus), Zif268 based [TaxId:10090] [64672] (2 PDB entries)
  8. 757962Domain d1g2df_: 1g2d F: [60221]
    clone 2

Details for d1g2df_

PDB Entry: 1g2d (more details), 2.2 Å

PDB Description: structure of a cys2his2 zinc finger/tata box complex (clone #2)
PDB Compounds: (F:) tata box zinc finger protein

SCOP Domain Sequences for d1g2df_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g2df_ k.12.1.1 (F:) TATA box-binding zinc finger, TATAZF {Mouse (Mus musculus), Zif268 based [TaxId: 10090]}
merpyacpvescdrrfsqktnldthirihtgqkpfqcricmrnfsqhtglnqhirthtge
kpfacdicgrkfatlhtrdrhtkihlrq

SCOP Domain Coordinates for d1g2df_:

Click to download the PDB-style file with coordinates for d1g2df_.
(The format of our PDB-style files is described here.)

Timeline for d1g2df_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1g2dc_