Lineage for d1g1yb3 (1g1y B:121-502)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 115904Fold c.1: TIM beta/alpha-barrel [51350] (24 superfamilies)
  4. 116348Superfamily c.1.8: (Trans)glycosidases [51445] (9 families) (S)
  5. 116349Family c.1.8.1: alpha-Amylases, N-terminal domain [51446] (13 proteins)
  6. 116481Protein Maltogenic amylase, central domain [51465] (2 species)
  7. 116482Species Thermoactinomyces vulgaris, TVAII [TaxId:2026] [51467] (4 PDB entries)
  8. 116486Domain d1g1yb3: 1g1y B:121-502 [60215]
    Other proteins in same PDB: d1g1ya1, d1g1ya2, d1g1yb1, d1g1yb2

Details for d1g1yb3

PDB Entry: 1g1y (more details), 3 Å

PDB Description: crystal structure of alpha-amylase ii (tvaii) from thermoactinomyces vulgaris r-47 and beta-cyclodextrin complex

SCOP Domain Sequences for d1g1yb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g1yb3 c.1.8.1 (B:121-502) Maltogenic amylase, central domain {Thermoactinomyces vulgaris, TVAII}
vfttpewakeaviyqifperfangdpsndppgteqwakdarprhdsfyggdlkgvidrlp
yleelgvtalyftpifaspshhkydtadylaidpqfgdlptfrrlvdeahrrgikiilda
vfnhagdqffafrdvlqkgeqsrykdwffiedfpvsktsrtnyetfavqvpampklrten
pevkeylfdvarfwmeqgidgwrldvanevdhafwrefrrlvkslnpdalivgaiwhdas
gwlmgdqfdsvmnylfresvirffatgeihaerfdaeltrarmlypeqaaqglwnlldsh
dterfltscggneakfrlavlfqmtylgtpliyygdeigmagatdpdcrrpmiweekeqn
rglfefykelirlrhrlasltr

SCOP Domain Coordinates for d1g1yb3:

Click to download the PDB-style file with coordinates for d1g1yb3.
(The format of our PDB-style files is described here.)

Timeline for d1g1yb3: