SCOPe 2.08: Domain d1g1yb2: 1g1y B:503-585

Lineage for d1g1yb2 (1g1y B:503-585)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families)
   this domain is C-terminal to the catalytic beta/alpha barrel domain

5. Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins)
   this domain follows the catalytic beta/alpha barrel domain

6. Protein Maltogenic amylase [51031] (4 species)

7. Species Thermoactinomyces vulgaris, TVAII [TaxId:2026] [51033] (12 PDB entries)

8. Domain d1g1yb2: 1g1y B:503-585 [60214]
   Other proteins in same PDB: d1g1ya1, d1g1ya3, d1g1yb1, d1g1yb3

Details for d1g1yb2

PDB Entry: 1g1y, 3 Å

PDB Description: crystal structure of alpha-amylase ii (tvaii) from thermoactinomyces vulgaris r-47 and beta-cyclodextrin complex

PDB Compounds: (B:) alpha-amylase II

SCOPe Domain Sequences for d1g1yb2:

Sequence; same for both SEQRES and ATOM records:

>d1g1yb2 b.71.1.1 (B:503-585) Maltogenic amylase {Thermoactinomyces vulgaris, TVAII [TaxId: 2026]}
gnvrswhadkqanlyafvrtvqdqhvgvvlnnrgekqtvllqvpesggktwldcltgeev
hgkqgqlkltlrpyqgmilwngr

Timeline for d1g1yb2:

• d1g1yb2 first appeared in SCOP 1.57
  
• d1g1yb2 appears in SCOPe 2.07