Lineage for d1g1yb1 (1g1y B:1-120)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 101937Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)
  4. 101938Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 104969Family b.1.1.5: E set domains [49208] (25 proteins)
  6. 105115Protein Maltogenic amylase, N-terminal domain [49221] (2 species)
  7. 105116Species Thermoactinomyces vulgaris, TVAII [TaxId:2026] [49223] (4 PDB entries)
  8. 105120Domain d1g1yb1: 1g1y B:1-120 [60213]
    Other proteins in same PDB: d1g1ya2, d1g1ya3, d1g1yb2, d1g1yb3

Details for d1g1yb1

PDB Entry: 1g1y (more details), 3 Å

PDB Description: crystal structure of alpha-amylase ii (tvaii) from thermoactinomyces vulgaris r-47 and beta-cyclodextrin complex

SCOP Domain Sequences for d1g1yb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g1yb1 b.1.1.5 (B:1-120) Maltogenic amylase, N-terminal domain {Thermoactinomyces vulgaris, TVAII}
mlleaifheakgsyaypisetqlrvrlrakkgdvvrcevlyadryaspeeelahalagka
gsderfdyfeallecstkrvkyvflltgpqgeavyfgetgfsaerskagvfqyayihrse

SCOP Domain Coordinates for d1g1yb1:

Click to download the PDB-style file with coordinates for d1g1yb1.
(The format of our PDB-style files is described here.)

Timeline for d1g1yb1: