![]() | Class b: All beta proteins [48724] (126 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.18: E set domains [81296] (18 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
![]() | Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (13 proteins) domains of unknown function associated with different type of catalytic domains in a different sequential location subgroup of the larger IPT/TIG domain family |
![]() | Protein Maltogenic amylase, N-terminal domain N [49221] (4 species) precedes the catalytic (beta/alpha)8-barrel domain |
![]() | Species Thermoactinomyces vulgaris, TVAII [TaxId:2026] [49223] (7 PDB entries) |
![]() | Domain d1g1ya1: 1g1y A:1-120 [60210] Other proteins in same PDB: d1g1ya2, d1g1ya3, d1g1yb2, d1g1yb3 |
PDB Entry: 1g1y (more details), 3 Å
SCOP Domain Sequences for d1g1ya1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1g1ya1 b.1.18.2 (A:1-120) Maltogenic amylase, N-terminal domain N {Thermoactinomyces vulgaris, TVAII} mlleaifheakgsyaypisetqlrvrlrakkgdvvrcevlyadryaspeeelahalagka gsderfdyfeallecstkrvkyvflltgpqgeavyfgetgfsaerskagvfqyayihrse
Timeline for d1g1ya1: