Lineage for d1g1ua_ (1g1u A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2011944Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2011945Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2011946Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. 2012742Protein Retinoid-X receptor alpha (RXR-alpha) [48510] (2 species)
  7. 2012743Species Human (Homo sapiens) [TaxId:9606] [48511] (35 PDB entries)
    Uniprot P19793 227-458
  8. 2012779Domain d1g1ua_: 1g1u A: [60204]

Details for d1g1ua_

PDB Entry: 1g1u (more details), 2.5 Å

PDB Description: the 2.5 angstrom resolution crystal structure of the rxralpha ligand binding domain in tetramer in the absence of ligand
PDB Compounds: (A:) Retinoic acid receptor RXR-alpha

SCOPe Domain Sequences for d1g1ua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g1ua_ a.123.1.1 (A:) Retinoid-X receptor alpha (RXR-alpha) {Human (Homo sapiens) [TaxId: 9606]}
pverileaelavepktetyveanmglnpsspndpvtnicqaadkqlftlvewakriphfs
elplddqvillragwnelliasfshrsiavkdgillatglhvhrnsahsagvgaifdrvl
telvskmrdmqmdktelgclraivlfnpdskglsnpaevealrekvyasleayckhkype
qpgrfaklllrlpalrsiglkclehlfffkligdtpidtflmemleap

SCOPe Domain Coordinates for d1g1ua_:

Click to download the PDB-style file with coordinates for d1g1ua_.
(The format of our PDB-style files is described here.)

Timeline for d1g1ua_: