SCOPe 2.08: Domain d1g1ba_: 1g1b A:

Lineage for d1g1ba_ (1g1b A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.190: Chorismate lyase-like [64287] (1 superfamily)
   duplication of alpha(2)-beta(3) motif; antiparallel beta sheet, order 123654

4. Superfamily d.190.1: Chorismate lyase-like [64288] (4 families)

5. Family d.190.1.1: Chorismate lyase [64289] (1 protein)
   automatically mapped to Pfam PF04345

6. Protein Chorismate lyase [64290] (1 species)

7. Species Escherichia coli [TaxId:562] [64291] (7 PDB entries)
   Uniprot P26602

8. Domain d1g1ba_: 1g1b A: [60202]
   complexed with phb

Details for d1g1ba_

PDB Entry: 1g1b, 1.99 Å

PDB Description: chorismate lyase (wild-type) with bound product

PDB Compounds: (A:) chorismate lyase

SCOPe Domain Sequences for d1g1ba_:

Sequence; same for both SEQRES and ATOM records:

>d1g1ba_ d.190.1.1 (A:) Chorismate lyase {Escherichia coli [TaxId: 562]}
shpaltqlralryckeipaldpqlldwllledsmtkrfeqqgktvsvtmiregfveqnei
peelpllpkesrywlreillcadgepwlagrtvvpvstlsgpelalqklgktplgrylft
sstltrdfieigrdaglwgrrsrlrlsgkpllltelflpasply

Timeline for d1g1ba_:

• d1g1ba_ first appeared in SCOP 1.57
  
• d1g1ba_ appears in SCOPe 2.07