Lineage for d1g15a_ (1g15 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2122050Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2123751Superfamily c.55.3: Ribonuclease H-like [53098] (15 families) (S)
    consists of one domain of this fold
  5. 2123752Family c.55.3.1: Ribonuclease H [53099] (5 protein domains)
  6. 2123933Protein RNase H (RNase HI) [53100] (4 species)
  7. 2123934Species Escherichia coli [TaxId:562] [53101] (33 PDB entries)
    Uniprot P0A7Y4
  8. 2123955Domain d1g15a_: 1g15 A: [60197]
    complexed with mn

Details for d1g15a_

PDB Entry: 1g15 (more details), 1.9 Å

PDB Description: co-crystal of e. coli rnase hi with two mn2+ ions bound in the the active site
PDB Compounds: (A:) ribonuclease hi

SCOPe Domain Sequences for d1g15a_:

Sequence, based on SEQRES records: (download)

>d1g15a_ c.55.3.1 (A:) RNase H (RNase HI) {Escherichia coli [TaxId: 562]}
kqveiftdgsalgnpgpggygailryrgrektfsagytrttnnrmelmaaivalealkeh
aevilstdsqyvrqgitqwihnwkargwktadkkpvknvdlwqrldaalgqhqikwewvk
ghaghpeneradelaraaamnptledtgyq

Sequence, based on observed residues (ATOM records): (download)

>d1g15a_ c.55.3.1 (A:) RNase H (RNase HI) {Escherichia coli [TaxId: 562]}
kqveiftdgsalgnpgpggygailryrgrektfsagytrttnnrmelmaaivalealkeh
aevilstdsqyvrqgitqwihnwkargwkpvknvdlwqrldaalgqhqikwewvghpene
radelaraaamnptledtgyq

SCOPe Domain Coordinates for d1g15a_:

Click to download the PDB-style file with coordinates for d1g15a_.
(The format of our PDB-style files is described here.)

Timeline for d1g15a_: