Class b: All beta proteins [48724] (177 folds) |
Fold b.95: Ganglioside M2 (gm2) activator [63706] (1 superfamily) sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds |
Superfamily b.95.1: Ganglioside M2 (gm2) activator [63707] (1 family) |
Family b.95.1.1: Ganglioside M2 (gm2) activator [63708] (1 protein) |
Protein Ganglioside M2 (gm2) activator [63709] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [63710] (8 PDB entries) Uniprot P17900 31-193 |
Domain d1g13c_: 1g13 C: [60196] complexed with epe |
PDB Entry: 1g13 (more details), 2 Å
SCOPe Domain Sequences for d1g13c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1g13c_ b.95.1.1 (C:) Ganglioside M2 (gm2) activator {Human (Homo sapiens) [TaxId: 9606]} ssfswdncdegkdpavirsltlepdpiivpgnvtlsvmgstsvplssplkvdlvlekeva glwikipctdyigsctfehfcdvldmliptgepcpeplrtyglpchcpfkegtyslpkse fvvpdlelpswlttgnyriesvlsssgkrlgcikiaaslkgi
Timeline for d1g13c_: