SCOP 1.75: Domain d1g13c_: 1g13 C:

Lineage for d1g13c_ (1g13 C:)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.95: Ganglioside M2 (gm2) activator [63706] (1 superfamily)
   sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds

4. Superfamily b.95.1: Ganglioside M2 (gm2) activator [63707] (1 family)

5. Family b.95.1.1: Ganglioside M2 (gm2) activator [63708] (1 protein)

6. Protein Ganglioside M2 (gm2) activator [63709] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [63710] (7 PDB entries)
   Uniprot P17900 31-193

8. Domain d1g13c_: 1g13 C: [60196]
   complexed with epe

Details for d1g13c_

PDB Entry: 1g13, 2 Å

PDB Description: human gm2 activator structure

PDB Compounds: (C:) ganglioside m2 activator protein

SCOP Domain Sequences for d1g13c_:

Sequence; same for both SEQRES and ATOM records:

>d1g13c_ b.95.1.1 (C:) Ganglioside M2 (gm2) activator {Human (Homo sapiens) [TaxId: 9606]}
ssfswdncdegkdpavirsltlepdpiivpgnvtlsvmgstsvplssplkvdlvlekeva
glwikipctdyigsctfehfcdvldmliptgepcpeplrtyglpchcpfkegtyslpkse
fvvpdlelpswlttgnyriesvlsssgkrlgcikiaaslkgi

Timeline for d1g13c_:

• d1g13c_ first appeared in SCOP 1.57
  
• d1g13c_ appears in SCOP 1.73
  
• d1g13c_ appears in SCOPe 2.01
  
• d1g13c_ appears in the current release, SCOPe 2.08