Lineage for d1g13c_ (1g13 C:)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 568714Fold b.95: Ganglioside M2 (gm2) activator [63706] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds
  4. 568715Superfamily b.95.1: Ganglioside M2 (gm2) activator [63707] (1 family) (S)
  5. 568716Family b.95.1.1: Ganglioside M2 (gm2) activator [63708] (1 protein)
  6. 568717Protein Ganglioside M2 (gm2) activator [63709] (1 species)
  7. 568718Species Human (Homo sapiens) [TaxId:9606] [63710] (4 PDB entries)
  8. 568727Domain d1g13c_: 1g13 C: [60196]
    complexed with epe

Details for d1g13c_

PDB Entry: 1g13 (more details), 2 Å

PDB Description: human gm2 activator structure

SCOP Domain Sequences for d1g13c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g13c_ b.95.1.1 (C:) Ganglioside M2 (gm2) activator {Human (Homo sapiens)}
ssfswdncdegkdpavirsltlepdpiivpgnvtlsvmgstsvplssplkvdlvlekeva
glwikipctdyigsctfehfcdvldmliptgepcpeplrtyglpchcpfkegtyslpkse
fvvpdlelpswlttgnyriesvlsssgkrlgcikiaaslkgi

SCOP Domain Coordinates for d1g13c_:

Click to download the PDB-style file with coordinates for d1g13c_.
(The format of our PDB-style files is described here.)

Timeline for d1g13c_: