SCOPe 2.02: Domain d1g10a_: 1g10 A:

Lineage for d1g10a_ (1g10 A:)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.137: Monooxygenase (hydroxylase) regulatory protein [56028] (1 superfamily)
   corner-like structure formed by two sheets and filled in with 2-3 helices

4. Superfamily d.137.1: Monooxygenase (hydroxylase) regulatory protein [56029] (1 family)
   duplication: consists of two beta-alpha-(beta)-beta(2) motifs; some topological similarity to the ferredoxin-like fold

5. Family d.137.1.1: Monooxygenase (hydroxylase) regulatory protein [56030] (4 proteins)
   note: the solution structure determinations disagree in the relative orientations of two motifs

6. Protein Toluene-4-monooxygenase catalytic effector protein [64394] (1 species)

7. Species Pseudomonas mendocina [TaxId:300] [64395] (15 PDB entries)

8. Domain d1g10a_: 1g10 A: [60191]

Details for d1g10a_

PDB Entry: 1g10

PDB Description: toluene-4-monooxygenase catalytic effector protein nmr structure

PDB Compounds: (A:) toluene-4-monooxygenase catalytic effector

SCOPe Domain Sequences for d1g10a_:

Sequence; same for both SEQRES and ATOM records:

>d1g10a_ d.137.1.1 (A:) Toluene-4-monooxygenase catalytic effector protein {Pseudomonas mendocina [TaxId: 300]}
stladqalhnnnvgpiiragdlvepvietaeidnpgkeitvedrrayvriaaegeliltr
ktleeqlgrpfnmqeleinlasfagqiqadedqirfyfdktm

Timeline for d1g10a_:

• d1g10a_ first appeared in SCOP 1.57
  
• d1g10a_ appears in SCOPe 2.01
  
• d1g10a_ appears in SCOPe 2.03
  
• d1g10a_ appears in the current release, SCOPe 2.08