Lineage for d1g10a_ (1g10 A:)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 84153Fold d.137: Monooxygenase (hydroxylase) regulatory protein [56028] (1 superfamily)
  4. 84154Superfamily d.137.1: Monooxygenase (hydroxylase) regulatory protein [56029] (1 family) (S)
  5. 84155Family d.137.1.1: Monooxygenase (hydroxylase) regulatory protein [56030] (3 proteins)
  6. 84164Protein Toluene-4-monooxygenase catalytic effector protein [64394] (1 species)
  7. 84165Species Pseudomonas mendocina [TaxId:300] [64395] (2 PDB entries)
  8. 84166Domain d1g10a_: 1g10 A: [60191]

Details for d1g10a_

PDB Entry: 1g10 (more details)

PDB Description: toluene-4-monooxygenase catalytic effector protein nmr structure

SCOP Domain Sequences for d1g10a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g10a_ d.137.1.1 (A:) Toluene-4-monooxygenase catalytic effector protein {Pseudomonas mendocina}
stladqalhnnnvgpiiragdlvepvietaeidnpgkeitvedrrayvriaaegeliltr
ktleeqlgrpfnmqeleinlasfagqiqadedqirfyfdktm

SCOP Domain Coordinates for d1g10a_:

Click to download the PDB-style file with coordinates for d1g10a_.
(The format of our PDB-style files is described here.)

Timeline for d1g10a_: