Lineage for d1g0va_ (1g0v A:)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 466492Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 466493Superfamily b.50.1: Acid proteases [50630] (2 families) (S)
  5. 466917Family b.50.1.2: Pepsin-like [50646] (10 proteins)
    duplication: consists of two similar barrel domains
    N-terminal: barrel, partly opened; n*=6, S*=10
  6. 466918Protein Acid protease [50649] (9 species)
  7. 466919Species Baker's yeast (Saccharomyces cerevisiae), proteinase A [TaxId:4932] [50654] (11 PDB entries)
    synonym: saccharopepsin
  8. 466921Domain d1g0va_: 1g0v A: [60189]
    Other proteins in same PDB: d1g0vb_

Details for d1g0va_

PDB Entry: 1g0v (more details), 2 Å

PDB Description: the structure of proteinase a complexed with a ia3 mutant, mvv

SCOP Domain Sequences for d1g0va_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g0va_ b.50.1.2 (A:) Acid protease {Baker's yeast (Saccharomyces cerevisiae), proteinase A}
gghdvpltnylnaqyytditlgtppqnfkvildtgssnlwvpsnecgslacflhskydhe
asssykangtefaiqygtgslegyisqdtlsigdltipkqdfaeatsepgltfafgkfdg
ilglgydtisvdkvvppfynaiqqdlldekrfafylgdtskdtenggeatfggideskfk
gditwlpvrrkaywevkfegiglgdeyaeleshgaaidtgtslitlpsglaeminaeiga
kkgstgqytldcntrdnlpdlifnfngynftigpydytlevsgscisaitpmdfpepvgp
laivgdaflrkyysiydlgnnavglakai

SCOP Domain Coordinates for d1g0va_:

Click to download the PDB-style file with coordinates for d1g0va_.
(The format of our PDB-style files is described here.)

Timeline for d1g0va_: