Class b: All beta proteins [48724] (180 folds) |
Fold b.50: Acid proteases [50629] (1 superfamily) barrel, closed; n=6, S=10, complex topology |
Superfamily b.50.1: Acid proteases [50630] (4 families) |
Family b.50.1.2: Pepsin-like [50646] (11 proteins) duplication: consists of two similar barrel domains N-terminal: barrel, partly opened; n*=6, S*=10 |
Protein Acid protease [50649] (9 species) |
Species Baker's yeast (Saccharomyces cerevisiae), proteinase A [TaxId:4932] [50654] (12 PDB entries) synonym: saccharopepsin |
Domain d1g0va_: 1g0v A: [60189] Other proteins in same PDB: d1g0vb_ complexed with man, nag; mutant |
PDB Entry: 1g0v (more details), 2 Å
SCOPe Domain Sequences for d1g0va_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1g0va_ b.50.1.2 (A:) Acid protease {Baker's yeast (Saccharomyces cerevisiae), proteinase A [TaxId: 4932]} gghdvpltnylnaqyytditlgtppqnfkvildtgssnlwvpsnecgslacflhskydhe asssykangtefaiqygtgslegyisqdtlsigdltipkqdfaeatsepgltfafgkfdg ilglgydtisvdkvvppfynaiqqdlldekrfafylgdtskdtenggeatfggideskfk gditwlpvrrkaywevkfegiglgdeyaeleshgaaidtgtslitlpsglaeminaeiga kkgstgqytldcntrdnlpdlifnfngynftigpydytlevsgscisaitpmdfpepvgp laivgdaflrkyysiydlgnnavglakai
Timeline for d1g0va_: