Lineage for d1g0sa_ (1g0s A:)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 83309Fold d.113: Nudix [55810] (1 superfamily)
  4. 83310Superfamily d.113.1: Nudix [55811] (2 families) (S)
  5. 83311Family d.113.1.1: MutT-like [55812] (3 proteins)
  6. 83312Protein ADP-ribose pyrophosphatase [64365] (1 species)
  7. 83313Species Escherichia coli [TaxId:562] [64366] (3 PDB entries)
  8. 83314Domain d1g0sa_: 1g0s A: [60187]

Details for d1g0sa_

PDB Entry: 1g0s (more details), 1.9 Å

PDB Description: the crystal structure of the e.coli adp-ribose pyrophosphatase

SCOP Domain Sequences for d1g0sa_:

Sequence, based on SEQRES records: (download)

>d1g0sa_ d.113.1.1 (A:) ADP-ribose pyrophosphatase {Escherichia coli}
mlkpdnlpvtfgkndveiiaretlyrgffsldlyrfrhrlfngqmshevrreiferghaa
vllpfdpvrdevvlieqiriaaydtsetpwllemvagmieegesvedvarreaieeagli
vkrtkpvlsflaspggtserssimvgevdattasgihgladenedirvhvvsreqayqwv
eegkidnaasvialqwlqlhhqalknewa

Sequence, based on observed residues (ATOM records): (download)

>d1g0sa_ d.113.1.1 (A:) ADP-ribose pyrophosphatase {Escherichia coli}
mlkpdnlpvtfgkndveiiaretlyrgffsldlyrfrhrlfngqmshevrreiferghaa
vllpfdpvrdevvlieqiriaaydtsetpwllemvagmieegesvedvarreaieeagli
vkrtkpvlsflaspggtserssimvgevdattasnedirvhvvsreqayqwveegkidna
asvialqwlqlhhqalknewa

SCOP Domain Coordinates for d1g0sa_:

Click to download the PDB-style file with coordinates for d1g0sa_.
(The format of our PDB-style files is described here.)

Timeline for d1g0sa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1g0sb_