Class c: Alpha and beta proteins (a/b) [51349] (107 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (9 families) |
Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (26 proteins) |
Protein 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) [51798] (1 species) |
Species Rice blast fungus (Magnaporthe grisea) [TaxId:148305] [51799] (4 PDB entries) |
Domain d1g0od_: 1g0o D: [60184] |
PDB Entry: 1g0o (more details), 1.7 Å
SCOP Domain Sequences for d1g0od_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1g0od_ c.2.1.2 (D:) 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) {Rice blast fungus (Magnaporthe grisea)} avtqprgeskydaipgplgpqsaslegkvalvtgagrgigremamelgrrgckvivnyan stesaeevvaaikkngsdaacvkanvgvvedivrmfeeavkifgkldivcsnsgvvsfgh vkdvtpeefdrvftintrgqffvareaykhleiggrlilmgsitgqakavpkhavysgsk gaietfarcmaidmadkkitvnvvapggiktdmyhavcreyipngenlsneevdeyaavq wsplrrvglpidiarvvcflasndggwvtgkvigidggacm
Timeline for d1g0od_: