Lineage for d1g0od_ (1g0o D:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2841375Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (73 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7

    has additional subdomain(s) that are not in the common domain
  6. 2841390Protein 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) [51798] (1 species)
  7. 2841391Species Fungus (Magnaporthe grisea) [TaxId:148305] [51799] (4 PDB entries)
  8. 2841395Domain d1g0od_: 1g0o D: [60184]
    complexed with ndp, pyq

Details for d1g0od_

PDB Entry: 1g0o (more details), 1.7 Å

PDB Description: structure of trihydroxynaphthalene reductase in complex with nadph and pyroquilon
PDB Compounds: (D:) trihydroxynaphthalene reductase

SCOPe Domain Sequences for d1g0od_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g0od_ c.2.1.2 (D:) 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) {Fungus (Magnaporthe grisea) [TaxId: 148305]}
avtqprgeskydaipgplgpqsaslegkvalvtgagrgigremamelgrrgckvivnyan
stesaeevvaaikkngsdaacvkanvgvvedivrmfeeavkifgkldivcsnsgvvsfgh
vkdvtpeefdrvftintrgqffvareaykhleiggrlilmgsitgqakavpkhavysgsk
gaietfarcmaidmadkkitvnvvapggiktdmyhavcreyipngenlsneevdeyaavq
wsplrrvglpidiarvvcflasndggwvtgkvigidggacm

SCOPe Domain Coordinates for d1g0od_:

Click to download the PDB-style file with coordinates for d1g0od_.
(The format of our PDB-style files is described here.)

Timeline for d1g0od_: