SCOP 1.73: Domain d1g0ob_: 1g0o B:

Lineage for d1g0ob_ (1g0o B:)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families)

5. Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (70 proteins)
   also known as short-chain dehydrogenases and SDR family
   parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7

6. Protein 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) [51798] (1 species)

7. Species Rice blast fungus (Magnaporthe grisea) [TaxId:148305] [51799] (4 PDB entries)

8. Domain d1g0ob_: 1g0o B: [60182]

Details for d1g0ob_

PDB Entry: 1g0o, 1.7 Å

PDB Description: structure of trihydroxynaphthalene reductase in complex with nadph and pyroquilon

PDB Compounds: (B:) trihydroxynaphthalene reductase

SCOP Domain Sequences for d1g0ob_:

Sequence; same for both SEQRES and ATOM records:

>d1g0ob_ c.2.1.2 (B:) 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]}
kydaipgplgpqsaslegkvalvtgagrgigremamelgrrgckvivnyanstesaeevv
aaikkngsdaacvkanvgvvedivrmfeeavkifgkldivcsnsgvvsfghvkdvtpeef
drvftintrgqffvareaykhleiggrlilmgsitgqakavpkhavysgskgaietfarc
maidmadkkitvnvvapggiktdmyhavcreyipngenlsneevdeyaavqwsplrrvgl
pidiarvvcflasndggwvtgkvigidggacm

Timeline for d1g0ob_:

• d1g0ob_ first appeared in SCOP 1.57
  
• d1g0ob_ appears in SCOP 1.71
  
• d1g0ob_ appears in SCOP 1.75
  
• d1g0ob_ appears in the current release, SCOPe 2.08