Lineage for d1g0ob_ (1g0o B:)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 66135Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
  4. 66136Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (9 families) (S)
  5. 66266Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (26 proteins)
  6. 66270Protein 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) [51798] (1 species)
  7. 66271Species Rice blast fungus (Magnaporthe grisea) [TaxId:148305] [51799] (4 PDB entries)
  8. 66273Domain d1g0ob_: 1g0o B: [60182]

Details for d1g0ob_

PDB Entry: 1g0o (more details), 1.7 Å

PDB Description: structure of trihydroxynaphthalene reductase in complex with nadph and pyroquilon

SCOP Domain Sequences for d1g0ob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g0ob_ c.2.1.2 (B:) 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) {Rice blast fungus (Magnaporthe grisea)}
kydaipgplgpqsaslegkvalvtgagrgigremamelgrrgckvivnyanstesaeevv
aaikkngsdaacvkanvgvvedivrmfeeavkifgkldivcsnsgvvsfghvkdvtpeef
drvftintrgqffvareaykhleiggrlilmgsitgqakavpkhavysgskgaietfarc
maidmadkkitvnvvapggiktdmyhavcreyipngenlsneevdeyaavqwsplrrvgl
pidiarvvcflasndggwvtgkvigidggacm

SCOP Domain Coordinates for d1g0ob_:

Click to download the PDB-style file with coordinates for d1g0ob_.
(The format of our PDB-style files is described here.)

Timeline for d1g0ob_: