| Class c: Alpha and beta proteins (a/b) [51349] (121 folds) |
| Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (10 families) ![]() |
| Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (33 proteins) also known as short-chain dehydrogenases and SDR family parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7 |
| Protein 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) [51798] (1 species) |
| Species Rice blast fungus (Magnaporthe grisea) [TaxId:148305] [51799] (4 PDB entries) |
| Domain d1g0oa_: 1g0o A: [60181] |
PDB Entry: 1g0o (more details), 1.7 Å
SCOP Domain Sequences for d1g0oa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1g0oa_ c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) {Rice blast fungus (Magnaporthe grisea)}
kydaipgplgpqsaslegkvalvtgagrgigremamelgrrgckvivnyanstesaeevv
aaikkngsdaacvkanvgvvedivrmfeeavkifgkldivcsnsgvvsfghvkdvtpeef
drvftintrgqffvareaykhleiggrlilmgsitgqakavpkhavysgskgaietfarc
maidmadkkitvnvvapggiktdmyhavcreyipngenlsneevdeyaavqwsplrrvgl
pidiarvvcflasndggwvtgkvigidggacm
Timeline for d1g0oa_: