Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (73 proteins) also known as short-chain dehydrogenases and SDR family parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7 has additional subdomain(s) that are not in the common domain |
Protein 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) [51798] (1 species) |
Species Fungus (Magnaporthe grisea) [TaxId:148305] [51799] (4 PDB entries) |
Domain d1g0oa_: 1g0o A: [60181] complexed with ndp, pyq |
PDB Entry: 1g0o (more details), 1.7 Å
SCOPe Domain Sequences for d1g0oa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1g0oa_ c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) {Fungus (Magnaporthe grisea) [TaxId: 148305]} kydaipgplgpqsaslegkvalvtgagrgigremamelgrrgckvivnyanstesaeevv aaikkngsdaacvkanvgvvedivrmfeeavkifgkldivcsnsgvvsfghvkdvtpeef drvftintrgqffvareaykhleiggrlilmgsitgqakavpkhavysgskgaietfarc maidmadkkitvnvvapggiktdmyhavcreyipngenlsneevdeyaavqwsplrrvgl pidiarvvcflasndggwvtgkvigidggacm
Timeline for d1g0oa_: