Lineage for d1g0ca_ (1g0c A:)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 814174Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 815285Superfamily c.1.8: (Trans)glycosidases [51445] (14 families) (S)
  5. 815744Family c.1.8.3: beta-glycanases [51487] (26 proteins)
    consist of a number of sequence families
  6. 815745Protein Alkaline cellulase K catalytic domain [63906] (1 species)
  7. 815746Species Bacillus sp. [TaxId:1409] [63907] (2 PDB entries)
  8. 815748Domain d1g0ca_: 1g0c A: [60165]
    complexed with cellobiose
    complexed with acy, cbi, cd

Details for d1g0ca_

PDB Entry: 1g0c (more details), 1.9 Å

PDB Description: alkaline cellulase k catalytic domain-cellobiose complex
PDB Compounds: (A:) endoglucanase

SCOP Domain Sequences for d1g0ca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g0ca_ c.1.8.3 (A:) Alkaline cellulase K catalytic domain {Bacillus sp. [TaxId: 1409]}
pagmqavkspseagalqlvelngqltlagedgtpvqlrgmsthglqwfgeivnenafval
sndwgsnmirlamyigengyatnpevkdlvyegielafehdmyvivdwhvhapgdpradv
ysgaydffeeiadhykdhpknhyiiwelanepspnnnggpgltndekgweavkeyaepiv
emlrekgdnmilvgnpnwsqrpdlsadnpidaenimysvhfytgshgashigypegtpss
ersnvmanvryaldngvavfatewgtsqangdggpyfdeadvwlnflnkhniswanwslt
nkneisgaftpfelgrtdatdldpganqvwapeelslsgeyvrarikgieytpidrtk

SCOP Domain Coordinates for d1g0ca_:

Click to download the PDB-style file with coordinates for d1g0ca_.
(The format of our PDB-style files is described here.)

Timeline for d1g0ca_: