Lineage for d1g0ca_ (1g0c A:)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 235645Fold c.1: TIM beta/alpha-barrel [51350] (26 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 236226Superfamily c.1.8: (Trans)glycosidases [51445] (9 families) (S)
  5. 236477Family c.1.8.3: beta-glycanases [51487] (14 proteins)
    consist of a number of sequence families
  6. 236478Protein Alkaline cellulase K catalytic domain [63906] (1 species)
  7. 236479Species Bacillus sp. [63907] (2 PDB entries)
  8. 236480Domain d1g0ca_: 1g0c A: [60165]
    complexed with cellobiose
    complexed with acy, cbi, cd

Details for d1g0ca_

PDB Entry: 1g0c (more details), 1.9 Å

PDB Description: alkaline cellulase k catalytic domain-cellobiose complex

SCOP Domain Sequences for d1g0ca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g0ca_ c.1.8.3 (A:) Alkaline cellulase K catalytic domain {Bacillus sp.}
pagmqavkspseagalqlvelngqltlagedgtpvqlrgmsthglqwfgeivnenafval
sndwgsnmirlamyigengyatnpevkdlvyegielafehdmyvivdwhvhapgdpradv
ysgaydffeeiadhykdhpknhyiiwelanepspnnnggpgltndekgweavkeyaepiv
emlrekgdnmilvgnpnwsqrpdlsadnpidaenimysvhfytgshgashigypegtpss
ersnvmanvryaldngvavfatewgtsqangdggpyfdeadvwlnflnkhniswanwslt
nkneisgaftpfelgrtdatdldpganqvwapeelslsgeyvrarikgieytpidrtk

SCOP Domain Coordinates for d1g0ca_:

Click to download the PDB-style file with coordinates for d1g0ca_.
(The format of our PDB-style files is described here.)

Timeline for d1g0ca_: