Lineage for d1g03a_ (1g03 A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2000631Fold a.73: Retrovirus capsid protein, N-terminal core domain [47942] (1 superfamily)
    core: 5 helices; bundle
  4. 2000632Superfamily a.73.1: Retrovirus capsid protein, N-terminal core domain [47943] (2 families) (S)
  5. 2000633Family a.73.1.1: Retrovirus capsid protein, N-terminal core domain [47944] (6 protein domains)
  6. 2000754Protein HTLV-I capsid protein [47949] (1 species)
  7. 2000755Species Human T-cell leukemia virus type 1 [TaxId:11908] [47950] (2 PDB entries)
  8. 2000757Domain d1g03a_: 1g03 A: [60162]

Details for d1g03a_

PDB Entry: 1g03 (more details)

PDB Description: nmr structure of n-terminal domain of htlv-i ca1-134
PDB Compounds: (A:) htlv-I capsid protein

SCOPe Domain Sequences for d1g03a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g03a_ a.73.1.1 (A:) HTLV-I capsid protein {Human T-cell leukemia virus type 1 [TaxId: 11908]}
pvmhphgappnhrpwqmkdlqaikqevsqaapgspqfmqtirlavqqfdptakdlqdllq
ylcsslvaslhhqqldsliseaetrgitsynplagplrvqannpqqqglrreyqqlwlaa
faalpgsakdpswa

SCOPe Domain Coordinates for d1g03a_:

Click to download the PDB-style file with coordinates for d1g03a_.
(The format of our PDB-style files is described here.)

Timeline for d1g03a_: